logo
BAi Store
  1. Machines
  2. Shop by Inspirations
  3. Embroidery Supplies
  4. Software
  5. Services
  6. Spare Parts
    • Programs

      • User Stories
      • H Coins
      • Refer a Friend
      • Affiliate Program
      • Hero Discount
avatar
Menu
results
View All
THE MIRROR
THE MIRROR

1st choice for entry-level commercial embroidery machine

THE VISION
THE VISION

Beast for structure hat embroidery

THE VISION-2HEADS
THE VISION-2HEADS

Powerful assistant for business growth

I'm a Newbie
I'm a Shop Owner
I Need to Embroider on Hats
I Need to Embroider on Clothes
  • Thread
  • Bobbin
  • Stabilizer
  • Needle
  • Hoop
  • Mighty Hoop & HoopMaster
  • Bundle
Thread
View All
  • THE MIRROR
  • THE VISION
  • THE VISION-2HEADS
THE MIRROR
View All
Institch Doodle Digitizing
Institch Doodle Digitizing

Doodle · Cloud Storage · Zero Learning Curve

Transmission software
Transmission Software

WiFi · Design Transfer · Machine Interconnection

cost calculator software
Cost Calculator Software

Quick Design Analysis · Pre-set Whiteboard Prices · Pre-set Supply Costs

  1. Machines
  2. Shop by Inspirations
  3. Embroidery Supplies
  4. Software
  5. Services
  6. Spare Parts
  7. Programs
  8. Account
THE MIRROR
THE MIRROR

1st choice for entry-level commercial embroidery machine

THE VISION
THE VISION

Beast for structure hat embroidery

THE VISION-2HEADS
THE VISION-2HEADS

Powerful assistant for business growth

Institch Doodle Digitizing
Institch Doodle Digitizing

Doodle · Cloud Storage · Zero Learning Curve

Transmission software
Transmission Software

WiFi · Design Transfer · Machine Interconnection

cost calculator software
Cost Calculator Software

Quick Design Analysis · Pre-set Whiteboard Prices · Pre-set Supply Costs

I'm a Newbie
I'm a Newbie
I'm a Shop Owner
I'm a Shop Owner
I Need to Embroider on Hats
I Need to Embroider on Hats
I Need to Embroider on Clothes
I Need to Embroider on Clothes
  1. THE MIRROR
  2. THE VISION
  3. THE VISION-2HEADS
  1. Thread
  2. Bobbin
  3. Stabilizer
  4. Needle
  5. Hoop
  6. Mighty Hoop & HoopMaster
  7. Bundle
THE MIRROR
EOC05

A professional embroidery machine, easy to use

THE VISION
EOC06

High-performance machine for next-level embroidery

  • User Stories
  • H Coins
  • Refer a Friend
  • Affiliate Program
  • Hero Discount
  • Free Patterns
  • Contact Engineer

Cart

0 items

Privacy Policy

Overview

Welcome to 100horse.com, a website operated by BAi Technology (Wuxi) Co., Ltd. Please carefully read the following privacy policy. By using this website, you agree to comply with these terms. If you do not agree, please stop accessing and using this website immediately.

This privacy policy outlines how we collect, process and use personal information on the website. It also describes how you can access, use and correct your personal information. If you do not agree with the data processing practices described in this privacy policy, please do not use the website or provide your badge scanning information at trade shows.

We may periodically update this privacy policy, so we encourage you to review it regularly for any changes.


Information We Collect

Information Collected During Website Browsing

You can browse this website without providing any personal information. However, when you visit the site, we automatically collect certain navigational information, such as your IP address, browser type, geographic location, referring source, duration of your visit and pages viewed.

Personal Information Collected via Online Forms, Trade Shows and Phone Calls

Personal information refers to any data voluntarily provided by you that identifies you, including but not limited to your name, email address, company name, address, phone number and other details relevant to you or your business. This also includes transaction information (free or paid) from the website or trade shows, as well as data shared during phone conversations with our staff. Additionally, we may collect publicly available information from social media platforms (e.g., Facebook, LinkedIn, Twitter, Google) or service providers. Payment-related information may also be collected when processing transactions via PayPal, such as credit card details provided for online purchases. Beyond this, we do not collect sensitive information online.

Automatically Collected Technical Information

When you use our services or browse the content we provide, we automatically gather information about your computer's hardware and software. This may include your IP address, browser type, domain names, Internet Service Provider (ISP), visited pages, operating system, clickstream data, access times and referring website addresses. This data is used to analyze website usage and may be combined with your personal information (e.g., name, email, address, phone number) to provide a more personalized experience.


How We Use Collected Information

  1. Compliance with Our Privacy Policy

    We use collected information in accordance with this privacy policy. Customers subscribing to our services are obligated to adhere to this policy through agreements with us.

  2. No Sale of Personal Information

    We will not sell your personal information to any third parties.

  3. Uses of Personal Information

    In addition to the purposes outlined elsewhere in this policy, your personal information may be used to:

    • Personalize your website experience and improve browsing interactions;
    • Send you information via email, SMS, or other means about products, services and marketing content related to 100 Horse Technology that we believe may interest you;
    • Promote our services and share promotional and product-related updates based on your preferences;
    • Send follow-up information or product reminder via SMS if you provide your phone number.
  4. Legal Compliance

    We may contact you on behalf of external business partners about products you may find of interest; however, your personal information will not be shared with third parties in such cases.


Legal Basis for Processing Personal Information (EEA Visitors Only)

If you are located in the European Economic Area (EEA), the legal basis for collecting and using your personal information depends on the context in which the information is collected. Generally, we process your personal information under the following circumstances:

  • Consent: Where you have explicitly consented, we collect and use your information based on your consent.
  • Contractual Necessity: If we need your personal information to perform a contract with you or take pre-contractual measures, we will collect and use your information accordingly.
  • Legitimate Interests: We may process your information based on our legitimate interests, provided this does not override your data protection rights or fundamental freedoms. We will make these interests clear at the relevant time.
  • Legal Obligations: In some cases, we may be legally required to collect and use your personal information.

If we request your personal information to comply with legal obligations or fulfill a contract, we will specify whether the information is mandatory and outline the consequences of not providing it.

Use of Navigational Information

We use navigational information to optimize and improve the website experience. This information may be combined with personal information to provide you with more personalized services and content.


Customer Testimonials, Reviews and Feedback

  1. Customer Testimonials and Reviews

    We may publish customer testimonials and reviews on the website, which could include personal information. If you do not wish for your testimonial or review to be displayed publicly, please contact us directly.

  2. Social Media Reviews

    Comments and reviews posted via our social media accounts (e.g., Twitter, Pinterest, Instagram, Facebook) may be used for marketing purposes on our website and shared via email. If you would like your comment or review removed, please contact us at support@100horse.com and we will remove the content and ensure it is no longer used for marketing purposes.


Use of Credit Card Information

If you provide credit card information, it will only be used to process payments and verify your financial eligibility. We work with third-party payment service providers to manage credit card transactions. These providers do not store, retain, or use your credit card information for any purpose other than processing payments.

Security of Your Personal Information

We employ a variety of security technologies and measures to protect your personal information from unauthorized access, use, or disclosure. Your personal information is stored on secure servers, safeguarded with appropriate physical, technical and organizational measures.

Social Media Features

Our website may include social media features (e.g., Facebook "Like" button) and widgets (e.g., "Share" button). These features may collect your IP address, track the pages you visit and set cookies to function properly. Social media features are either hosted by third parties or directly on our website. Note that the use of these features is governed by the privacy policies of the respective companies providing them, not by this privacy policy.

External Websites

Our website may contain links to external websites. We do not control or endorse the content or privacy practices of these sites and are not responsible for their policies. Please review the privacy policies of any external sites you visit.

Public Forums

We may offer publicly accessible blogs or social media groups. Be aware that any information you share on these platforms may be collected and used by others. If you wish to correct or remove your information from these platforms, please contact us.


How We Share Collected Information

  • Service Providers

    We may partner with third-party service providers to deliver products, information, or services. Your personal information may be shared with these providers, who are required to comply with our privacy policy.

  • Partners

    We may share data with trusted partners to assist with marketing, statistical analysis, or customer service. These partners are obligated to adhere to our privacy and data protection policies.

  • Corporate Events

    In the event of a company acquisition or asset transfer (e.g., merger, acquisition, or bankruptcy), your personal information may be transferred. We will notify you via email or website updates regarding any changes in ownership and provide information on managing your personal information.

  • Mandatory Disclosure

    We may disclose your personal information if required by law or to protect our legal rights, investigate fraud, or ensure the safety of you or others.


Cookies

BAi and its partners use cookies and similar technologies (e.g., web beacons) to analyze trends, manage the website, track user activity and collect statistical data about our user base. For details on how we use cookies and how to manage your preferences, please refer to our Cookie Policy.

Accessing and Controlling Your Personal Data

  • Reviewing, Correcting and Deleting Personal Information

    You have the right to request access to, correction, updating, or deletion of your personal information. You may also request the restriction of processing or the transfer of your personal information to other service providers.

  • Withdrawing Consent

    If we process your personal information based on your consent, you have the right to withdraw that consent at any time. Withdrawing consent will not affect the legality of any processing conducted prior to withdrawal or processing based on other lawful grounds.


Contact Information

100 Horse Technology (Wuxi) Co., Ltd

Email: support@100horse.com

Phone:+86 189 0063 0238

Never miss any deals

Subscribe now to get special offers, free giveaways and one-step deal.

By submitting, you agree to our Privacy Policy and Terms of use.

About Us
  • About BAi Store
  • User Stories
Service Center
  • Learn
  • Training
  • Repair
  • Spare Parts
Software
  • Transmission Software
  • Embroidery Cost Calculator
  • Institch Doodle Digitizing
Shop by Inspirations
  • I'm a Newbie
  • I'm a Shop Owner
  • I Need to Embroider on Hats
  • I Need to Embroider on Clothes
Our Programs
  • H Coins
  • Refer a Friend
  • Affiliate Program
  • Hero Discount
Our Policy
  • Shipping Policy
  • Payment Policy
  • Returns & Refunds
  • After Sales Policy
facebookyoutubeinsreddittiktoktwitter
visamasterdiscoveramexklarnaafterpaypaypalpaypalpaypalpaypalaffirm

Copyright © 2026 BAi All Rights Reserved.

  • Privacy Policy
  • Terms of Use
  • Warranty
Chat
1

Send Inquiry

+1